Web Analysis for Happyvalentinesdayimageswishes - happyvalentinesdayimageswishes.com
Happy Valentines Day Images Happy Valentines day Wishes Valentin's Day Images Valentine's day wishes Happy valentines day Pictures Rose day Images And
happyvalentinesdayimageswishes.com is 8 years 3 months old. It is a domain having com extension. It has a global traffic rank of #1357841 in the world. This website is estimated worth of $ 480.00 and have a daily income of around $ 2.00. As no active threats were reported recently by users, happyvalentinesdayimageswishes.com is SAFE to browse.
PageSpeed Score
Siteadvisor Rating
Not Applicable
Traffic Report
| Daily Unique Visitors: | 354 |
| Daily Pageviews: | 708 |
Estimated Valuation
| Income Per Day: | $ 2.00 |
| Estimated Worth: | $ 480.00 |
Search Engine Indexes
| Google Indexed Pages: | Not Applicable |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | Not Applicable |
| Bing Backlinks: | Not Applicable |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | Not Applicable |
| WOT Trustworthiness: | Not Applicable |
| WOT Child Safety: | Not Applicable |
Website Ranks & Scores
| Alexa Rank: | 1,357,841 |
| Domain Authority: | Not Applicable |
Web Server Information
Hosted IP Address:
198.46.149.193
Hosted Country:
US
Location Latitude:
42.8864Location Longitude:
-78.8781Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
| H1 Headings: | Not Applicable | H2 Headings: | 10 |
| H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
| H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
| Total IFRAMEs: | Not Applicable | Total Images: | 15 |
| Google Adsense: | Not Applicable | Google Analytics: | UA-72602389-2 |
Websites Hosted on Same IP (i.e. 198.46.149.193)
Ngo In India | Education For Poor Children | Donate Online For Underpr
NISHTHA SPECIAL SCHOOL is an NGO in India. Our main aim is to provide education for underprivileged children, girl child, and give support for poor children's health. Donate for education to support poor children.
Not Applicable
$
8.95
HTTP Header Analysis
Date: Wed, 17 Feb 2016 03:36:40 GMT
Server: Apache/2.2.29 (Unix) mod_ssl/2.2.29 OpenSSL/1.0.1e-fips mod_bwlimited/1.4
X-Powered-By: PHP/5.4.34
Link: <http://www.happyvalentinesdayimageswishes.com/wp-json/>; rel="https://api.w.org/"
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
Domain Information
| Domain Registrar: |
GoDaddy.com, LLC
|
|---|---|
| Registration Date: | Jan 29, 2016, 12:00 AM 8 years 3 months 2 weeks ago |
| Last Modified: | Jan 30, 2016, 12:00 AM 8 years 3 months 2 weeks ago |
| Expiration Date: | Jan 29, 2017, 12:00 AM 7 years 3 months 1 week ago |
| Domain Status: |
clientDeleteProhibited
clientRenewProhibited
clientTransferProhibited
clientUpdateProhibited
|
Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| dns100.jtecloud.com |
|
144.91.102.204 |
Germany
|
| dns200.jtecloud.com |
|
144.91.102.204 |
Germany
|
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| happyvalentinesdayimageswishes.com | A | 14386 |
IP: 198.46.149.193 |
| happyvalentinesdayimageswishes.com | NS | 21599 |
Target: dns100.jtecloud.com |
| happyvalentinesdayimageswishes.com | NS | 21599 |
Target: dns200.jtecloud.com |
| happyvalentinesdayimageswishes.com | SOA | 21599 |
MNAME: dns100.jtecloud.com RNAME: jtegroup.gmail.com Serial: 2016013002 Refresh: 3600 Retry: 7200 Expire: 1209600 Minimum TTL: 86400 |
| happyvalentinesdayimageswishes.com | MX | 14399 |
Target: happyvalentinesdayimageswishes.com |
Similarly Ranked Websites
Ariel Atom Chat
Worldwide Ariel Atom discussion forum for all Ariel Atom owners and enthusiasts. Technical discussion, marketplace, photos, videos, parts, and more.
1,357,842
$
960.00
Suspended
Association sans but lucratif regroupant les enseignantes et enseignants des collèges du Québec enseignant les techniques d'éducation à l'enfance.
1,357,844
$
480.00
Homeless Programs & Services | Homeless Shelters | Midnight Mission |
The Midnight Mission has been helping people experiencing homelessness transform their lives since 1914, learn more & get involved today!
1,357,845
$
8.95
The Mustang Shop - Performance, Restoration, & Classic Mustang Parts
1,357,851
$
8.95
Ecom Savage | Dropshipping Course
The number one top easy to understand Dropshipping course. Learn how to Dropship on Shopify in 1 day!
1,357,851
$
960.00
Full WHOIS Lookup
Registrar URL: http://www.godaddy.com
Registrant Name: sandeep yadav
Registrant Organization:
Name Server: DNS100.JTECLOUD.COM
Name Server: DNS200.JTECLOUD.COM
DNSSEC: unsigned
For complete domain details go to:
http://who.godaddy.com/whoischeck.aspx?domain=happyvalentinesdayimageswishes.com
The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.
Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.
